TA338621 CYP3A43 antibody

Rabbit Polyclonal Anti-CYP3A43 Antibody

See related secondary antibodies

Search for all "CYP3A43"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Rabbit, Rat, Sheep CYP3A43

Product Description for CYP3A43

Rabbit anti Bovine, Canine, Guinea Pig, Human, Rabbit, Rat, Sheep CYP3A43.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYP3A43

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytochrome P450 3A43
Presentation Purified
Reactivity Bov, Can, GP, Hu, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB55
Immunogen:
The immunogen for anti-CYP3A43 antibody: synthetic peptide directed towards the middle region of human CYP3A43. Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII.
GeneID:
64816
Application WB
Background CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygeses which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alterte splicing of this gene results in three transcript variants encoding different isoforms.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygeses which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alterte splicing of this gene results in three transcript variants encoding different isoforms.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CYP3A43 (2 products)

Catalog No. Species Pres. Purity   Source  

CYP3A43

CYP3A43 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CYP3A43

CYP3A43 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CYP3A43 (4 products)

Catalog No. Species Pres. Purity   Source  

CYP3A43 293T Cell Transient Overexpression Lysate(Denatured)

CYP3A43 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CYP3A43 overexpression lysate

CYP3A43 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CYP3A43 overexpression lysate

CYP3A43 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CYP3A43 overexpression lysate

CYP3A43 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn