TA338625 CASD1 antibody

Rabbit Polyclonal Anti-CASD1 Antibody

See related secondary antibodies

Search for all "CASD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Porcine, Rat CASD1

Product Description for CASD1

Rabbit anti Bovine, Human, Mouse, Porcine, Rat CASD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CASD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C7orf12, CAS1 domain-containing protein 1, Nbla04196
Presentation Purified
Reactivity Bov, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PB1
Immunogen:
The immunogen for anti-CASD1 antibody: synthetic peptide directed towards the N terminal of human CASD1. Synthetic peptide located within the following region: MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE.
GeneID:
64921
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CASD1 (1 products)

Catalog No. Species Pres. Purity   Source  

CASD1 Lysate

Western Blot: CASD1 Lysate [NBL1-08702] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CASD1
  Novus Biologicals Inc.
  • LinkedIn