TA338627 REEP1 antibody

Rabbit Polyclonal Anti-REEP1 Antibody

See related secondary antibodies

Search for all "REEP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish REEP1

Product Description for REEP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish REEP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for REEP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C2orf23, Receptor expression-enhancing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H902
Immunogen:
The immunogen for anti-REEP1 antibody: synthetic peptide directed towards the middle region of human REEP1. Synthetic peptide located within the following region: AKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTI.
GeneID:
65055
Application WB
Background REEP1 belongs to the DP1 family and may enhance the cell surface expression of odorant receptors.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for REEP1 (1 products)

Catalog No. Species Pres. Purity   Source  

REEP1

REEP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for REEP1 (3 products)

Catalog No. Species Pres. Purity   Source  

REEP1 Lysate

Western Blot: REEP1 Lysate [NBL1-15266] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for REEP1
  Novus Biologicals Inc.

REEP1 overexpression lysate

REEP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

REEP1 overexpression lysate

REEP1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn