TA338637 EGFL9 antibody

Rabbit Polyclonal Anti-Dlk2 Antibody

See related secondary antibodies

Search for all "EGFL9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EGFL9

Product Description for EGFL9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat EGFL9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EGFL9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DLK-2, DLK2, EGF like protein 9, EGF-like protein 9, Epidermal growth factor-like protein 9, Protein delta homolog 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8K1E3
Immunogen:
The immunogen for Anti-Dlk2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dlk2. Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE.
GeneID:
106565
Application WB
Background Dlk2 regulates adipogenesis.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn