TA338642 YIPF2 antibody

Rabbit Polyclonal Anti-YIPF2 Antibody

See related secondary antibodies

Search for all "YIPF2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat YIPF2

Product Description for YIPF2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat YIPF2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for YIPF2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms YIP1 family member 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BWQ6
Immunogen:
The immunogen for anti-YIPF2 antibody: synthetic peptide directed towards the middle region of human YIPF2. Synthetic peptide located within the following region: LTLVLAQRRDPSIHYSPQFHKVTVAGISIYCYAWLVPLALWGFLRWRKGV.
GeneID:
78992
Application WB
Background The function of YIPF2 remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for YIPF2 (1 products)

Catalog No. Species Pres. Purity   Source  

YIPF2

YIPF2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.
  • LinkedIn