TA338670 ACBD4 antibody

Rabbit Polyclonal Anti-ACBD4 Antibody

See related secondary antibodies

Search for all "ACBD4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ACBD4

Product Description for ACBD4

Rabbit anti Bovine, Canine, Human, Mouse, Rat ACBD4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ACBD4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acyl-CoA-binding domain-containing protein 4, HMFT0700
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NC06
Immunogen:
Synthetic peptide directed towards the N terminal of human ACBD4
AA Sequence:
NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
GeneID:
79777
Application

Western blotting (0.2 - 1 µg/ml)

Background ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.
General Readings Yamada,S., (2004) Oncogene 23 (35), 5901-5911
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog, Rabbit, Guinea Pig
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ACBD4 (4 products)

Catalog No. Species Pres. Purity   Source  

ACBD4 (transcript variant 2)

ACBD4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ACBD4 (transcript variant 4)

ACBD4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ACBD4

ACBD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACBD4

ACBD4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ACBD4 (5 products)

Catalog No. Species Pres. Purity   Source  

ACBD4 293T Cell Transient Overexpression Lysate(Denatured)

ACBD4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACBD4 Lysate

Western Blot: ACBD4 Lysate [NBL1-07227] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACBD4 Protein
  Novus Biologicals Inc.

ACBD4 overexpression lysate

ACBD4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ACBD4 overexpression lysate

ACBD4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

ACBD4 overexpression lysate

ACBD4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn