TA338673 UGT2A3 antibody

Rabbit Polyclonal Anti-UGT2A3 Antibody

See related secondary antibodies

Search for all "UGT2A3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human UGT2A3

Product Description for UGT2A3

Rabbit anti Human UGT2A3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UGT2A3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UDP-glucuronosyltransferase 2A3, UDPGT 2A3, UNQ2559/PRO6239
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWM9
Immunogen:
The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN.
GeneID:
79799
Application WB
Background UGT2A3 is a single-pass type I membrane proteinPotential. It belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimition of potentially toxic xenobiotics and endogenous compounds.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for UGT2A3 (2 products)

Catalog No. Species Pres. Purity   Source  

UGT2A3

UGT2A3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UGT2A3

UGT2A3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UGT2A3 (1 products)

Catalog No. Species Pres. Purity   Source  

UGT2A3 293T Cell Transient Overexpression Lysate(Denatured)

UGT2A3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn