TA338683 TMC7 antibody

Rabbit Polyclonal Anti-TMC7 Antibody

See related secondary antibodies

Search for all "TMC7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMC7

Product Description for TMC7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish TMC7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMC7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane channel-like protein 7
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z402
Immunogen:
The immunogen for Anti-TMC7 antibody is: synthetic peptide directed towards the N-terminal region of Human TMC7. Synthetic peptide located within the following region: SWKRFLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLV.
GeneID:
79905
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMC7 (2 products)

Catalog No. Species Pres. Purity   Source  

TMC7

TMC7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMC7

TMC7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn