TA338697 MOGAT2 antibody

Rabbit Polyclonal Anti-MOGAT2 Antibody

See related secondary antibodies

Search for all "MOGAT2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MOGAT2

Product Description for MOGAT2

Rabbit anti Human MOGAT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MOGAT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 2-acylglycerol O-acyltransferase 2, Acyl CoA:monoacylglycerol acyltransferase 2, DC5, DGAT2L5, Diacylglycerol O-acyltransferase candidate 5, Diacylglycerol acyltransferase 2-like protein 5, Monoacylglycerol O-acyltransferase 2, hDC5, hMGAT2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3SYC2
Immunogen:
The immunogen for anti-MOGAT2 antibody: synthetic peptide directed towards the middle region of human MOGAT2. Synthetic peptide located within the following region: LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN.
GeneID:
80168
Application WB
Background Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MOGAT2 (4 products)

Catalog No. Species Pres. Purity   Source  

MOGAT2

MOGAT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MOGAT2

MOGAT2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MOGAT2

MOGAT2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MOGAT2

MOGAT2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MOGAT2 (3 products)

Catalog No. Species Pres. Purity   Source  

MOGAT2 293T Cell Transient Overexpression Lysate(Denatured)

MOGAT2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MOGAT2 Lysate

Western Blot: MOGAT2 Lysate [NBL1-13177] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MOGAT2
  Novus Biologicals Inc.

MOGAT2 overexpression lysate

MOGAT2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn