TA338698 TRPV4 / Vanilloid receptor-like protein 2 antibody

Rabbit Polyclonal Anti-TRPV4 Antibody

See related secondary antibodies

Search for all "TRPV4 / Vanilloid receptor-like protein 2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRPV4 / Vanilloid receptor-like protein 2

TA338698

More Views

  • TA338698

Product Description for TRPV4 / Vanilloid receptor-like protein 2

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TRPV4 / Vanilloid receptor-like protein 2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TRPV4 / Vanilloid receptor-like protein 2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OTRPC4, Osm-9-like TRP channel 4, TRP12, Transient receptor potential cation channel subfamily V member 4, Transient receptor potential protein 12, VR-OAC, VRL-2, VRL2, VROAC, Vanilloid receptor-related osmotically-activated channel
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HBA0
Immunogen:
The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR.
GeneID:
59341
Application WB
IHC
Background This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TRPV4 / Vanilloid receptor-like protein 2 (4 products)

Catalog No. Species Pres. Purity   Source  

TRPV4 Lysate

Western Blot: TRPV4 Lysate [NBL1-17343] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRPV4
  Novus Biologicals Inc.

TRPV4 Lysate

Western Blot: TRPV4 Lysate [NBL1-17344] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRPV4
  Novus Biologicals Inc.

TRPV4 overexpression lysate

TRPV4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

TRPV4 overexpression lysate

TRPV4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn