TA338715 KCNA7 antibody

Rabbit Polyclonal Anti-KCNA7 Antibody

See related secondary antibodies

Search for all "KCNA7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat KCNA7

Product Description for KCNA7

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat KCNA7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNA7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KCNC7, Potassium voltage-gated channel subfamily A member 7, Voltage-gated potassium channel subunit Kv1.7
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96RP8
Immunogen:
The immunogen for anti-KCNA7 antibody: synthetic peptide directed towards the C terminal of human KCNA7. Synthetic peptide located within the following region: GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV.
GeneID:
3743
Application WB
Background Potassium channels represent the most complex class of voltage-gated ion channels from both functiol and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neurol excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. The gene is expressed preferentially in skeletal muscle, heart and kidney. It is a candidate gene for inherited cardiac disorders. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KCNA7 (2 products)

Catalog No. Species Pres. Purity   Source  

KCNA7 Lysate

Western Blot: KCNA7 Lysate [NBL1-12140] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNA7
  Novus Biologicals Inc.

KCNA7 overexpression lysate

KCNA7 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn