TA338721 BTBD10 antibody

Rabbit Polyclonal Anti-BTBD10 Antibody

See related secondary antibodies

Search for all "BTBD10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat BTBD10

Product Description for BTBD10

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat BTBD10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BTBD10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein 10
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BSF8
Immunogen:
The immunogen for anti-BTBD10 antibody: synthetic peptide directed towards the N terminal of human BTBD10. Synthetic peptide located within the following region: AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL.
GeneID:
84280
Application WB
Background BTBD10 appears to behave as a suppressor of cell death including neurol cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BTBD10 (1 products)

Catalog No. Species Pres. Purity   Source  

BTBD10 (full length, N-term HIS tag)

BTBD10 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for BTBD10 (2 products)

Catalog No. Species Pres. Purity   Source  

BTBD10 293T Cell Transient Overexpression Lysate(Denatured)

BTBD10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

BTBD10 Lysate

Western Blot: BTBD10 Lysate [NBL1-08041] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for BTBD10. Protein
  Novus Biologicals Inc.
  • LinkedIn