TA338723 KCNK4 antibody

Rabbit Polyclonal Anti-KCNK4 Antibody

See related secondary antibodies

Search for all "KCNK4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat KCNK4

Product Description for KCNK4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat KCNK4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNK4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KCNK4, Potassium channel subfamily K member 4, TRAAK, TWIK-related arachidonic acid-stimulated potassium channel protein, Two pore K(+) channel KT4.1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYG8
Immunogen:
The immunogen for anti-KCNK4 antibody: synthetic peptide directed towards the N terminal of human KCNK4. Synthetic peptide located within the following region: MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH.
GeneID:
50801
Application WB
Background Potassium channels play a role in many cellular processes including maintence of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNK4 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNK4

KCNK4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for KCNK4 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNK4 Lysate

Western Blot: KCNK4 Lysate [NBL1-12185] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNK4
  Novus Biologicals Inc.
  • LinkedIn