TA338733 KCNH8 antibody

Rabbit Polyclonal Anti-Kcnh8 Antibody

See related secondary antibodies

Search for all "KCNH8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KCNH8

Product Description for KCNH8

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KCNH8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNH8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ELK channel 3, ELK1, ELK3, Ether-a-go-go-like potassium channel 3, KCNH8, Potassium voltage-gated channel subfamily H member 8, Voltage-gated potassium channel subunit Kv12.1, hElk1
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96L42
Immunogen:
The immunogen for anti-Kcnh8 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGSSPQRTEAHEQNPADSELHHSPNLDYSPSHCQVIQEGHLQFLRCISP.
GeneID:
131096
Application WB
Background Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, outward rectifying current (By similarity). Channel properties may be modulated by cAMP and subunit assembly.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KCNH8 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNH8 Lysate

Western Blot: KCNH8 Lysate [NBL1-12157] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNH8
  Novus Biologicals Inc.
  • LinkedIn