TA338738 KCTD7 antibody

Rabbit Polyclonal Anti-KCTD7 Antibody

See related secondary antibodies

Search for all "KCTD7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KCTD7

TA338738

More Views

  • TA338738
  • TA338738
  • TA338738

Product Description for KCTD7

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat KCTD7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCTD7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB/POZ domain-containing protein KCTD7
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MP8
Immunogen:
The immunogen for anti-KCTD7 antibody: synthetic peptide directed towards the N terminal of human KCTD7. Synthetic peptide located within the following region: VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE.
GeneID:
154881
Application WB
Background This gene encodes a member of the potassium channel tetramerization domain-containing protein family. Family members are identified on a structural basis and contain an amino-termil domain similar to the T1 domain present in the voltage-gated potassium channel. Mutations in this gene have been associated with progressive myoclonic epilepsy-3. Altertive splicing results in multiple transcript variants.[provided by RefSeq, Jan 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCTD7 (4 products)

Catalog No. Species Pres. Purity   Source  

KCTD7 (transcript variant 2)

KCTD7 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KCTD7 (full length, N-term HIS tag, transcript variant 1)

KCTD7 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

KCTD7

KCTD7 Human Purified
  Abnova Taiwan Corp.

KCTD7

KCTD7 Human Purified
  Abnova Taiwan Corp.

Positive controls for KCTD7 (2 products)

Catalog No. Species Pres. Purity   Source  

KCTD7 293T Cell Transient Overexpression Lysate(Denatured)

KCTD7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

KCTD7 overexpression lysate

KCTD7 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn