TA338741 KCNJ1 antibody

Rabbit Polyclonal Anti-KCNJ1 Antibody

See related secondary antibodies

Search for all "KCNJ1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KCNJ1

TA338741

More Views

  • TA338741

Product Description for KCNJ1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KCNJ1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNJ1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-regulated potassium channel ROM-K, ATP-sensitive inward rectifier potassium channel 1, KCNJ1, Kir1.1, Potassium channel, ROMK1, inwardly rectifying subfamily J member 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48048
Immunogen:
The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1. Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP.
GeneID:
3758
Application WB
Background Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by interl ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antetal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNJ1 (5 products)

Catalog No. Species Pres. Purity   Source  

KCNJ1

KCNJ1 Human
  Abnova Taiwan Corp.

KCNJ1

KCNJ1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KCNJ1

KCNJ1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KCNJ1

KCNJ1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KCNJ1

KCNJ1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KCNJ1 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNJ1 Lysate

Western Blot: KCNJ1 Lysate [NBL1-12162] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNJ1
  Novus Biologicals Inc.
  • LinkedIn