TA338752 KCNQ2 antibody

Rabbit Polyclonal Anti-KCNQ2 Antibody

See related secondary antibodies

Search for all "KCNQ2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KCNQ2

TA338752

More Views

  • TA338752

Product Description for KCNQ2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KCNQ2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KCNQ2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KQT-like 2, KvLQT2, Neuroblastoma-specific potassium channel subunit alpha KvLQT2, Potassium voltage-gated channel subfamily KQT member 2, Voltage-gated potassium channel subunit Kv7.2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43526
Immunogen:
The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH.
GeneID:
3785
Application WB
IHC
Background The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neurol excitability. The M channel is formed by the association of the protein encoded by this gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in this gene are a cause of benign familial neotal convulsions type 1 (BFNC), also known as epilepsy, benign neotal type 1 (EBN1). At least five transcript variants encoding five different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNQ2 (3 products)

Catalog No. Species Pres. Purity   Source  

KCNQ2

KCNQ2 Human
  Abnova Taiwan Corp.

KCNQ2

KCNQ2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

KCNQ2

KCNQ2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for KCNQ2 (3 products)

Catalog No. Species Pres. Purity   Source  

KCNQ2 Lysate(Denatured)

KCNQ2 Lysate(Denatured)
  Abnova Taiwan Corp.

KCNQ2 Lysate

KCNQ2 Lysate
  Novus Biologicals Inc.

KCNQ2 overexpression lysate

KCNQ2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn