TA338760 KCNG4 antibody

Rabbit Polyclonal Anti-KCNG4 Antibody

See related secondary antibodies

Search for all "KCNG4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KCNG4

Product Description for KCNG4

Rabbit anti Human KCNG4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNG4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Potassium voltage-gated channel subfamily G member 4, Voltage-gated potassium channel subunit Kv6.4
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TDN1
Immunogen:
The immunogen for anti-KCNG4 antibody: synthetic peptide directed towards the N terminal of human KCNG4. Synthetic peptide located within the following region: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP.
GeneID:
93107
Application WB
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functiol and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neurol excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The gene has strong expression in brain. Multiple altertively spliced variants have been found in normal and cancerous tissues. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn