TA338763 KCNH6 antibody

Rabbit Polyclonal Anti-KCNH6 Antibody

See related secondary antibodies

Search for all "KCNH6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KCNH6

Product Description for KCNH6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish KCNH6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KCNH6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ERG2, Eag-related protein 2, Ether-a-go-go-related gene potassium channel 2, Ether-a-go-go-related protein 2, HERG2, KCNH6, Kv11.2, Potassium voltage-gated channel subfamily H member 6, Voltage-gated potassium channel subunit Kv11.2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H252
Immunogen:
The immunogen for anti-KCNH6 antibody: synthetic peptide directed towards the middle region of human KCNH6. Synthetic peptide located within the following region: LSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPGKSSADVRAL.
GeneID:
81033
Application WB
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functiol and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neurol excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Altertive splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNH6 (3 products)

Catalog No. Species Pres. Purity   Source  

KCNH6

KCNH6 Human in vitro transl.
  Abnova Taiwan Corp.

KCNH6

KCNH6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KCNH6

KCNH6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KCNH6 (2 products)

Catalog No. Species Pres. Purity   Source  

KCNH6 Lysate

Western Blot: KCNH6 Lysate [NBL1-12155] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KCNH6
  Novus Biologicals Inc.

KCNH6 overexpression lysate

KCNH6 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn