TA338771 KCNIP2 antibody

Rabbit Polyclonal Anti-KCNIP2 Antibody

See related secondary antibodies

Search for all "KCNIP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KCNIP2

TA338771

More Views

  • TA338771

Product Description for KCNIP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish KCNIP2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KCNIP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, KCHIP2, KCNIP2, Kv channel-interacting protein 2, Potassium channel-interacting protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NS61-6
Immunogen:
The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the N terminal of human KCNIP2. Synthetic peptide located within the following region: QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS.
GeneID:
30819
Application WB
IHC
Background This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of tive Kv4 channel complexes. They may regulate A-type currents, and hence neurol excitability, in response to changes in intracellular calcium. Multiple altertively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn