TA338782 ZACN / LGICZ antibody

Rabbit Polyclonal Anti-LGICZ1 Antibody

See related secondary antibodies

Search for all "ZACN / LGICZ"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit ZACN / LGICZ

Product Description for ZACN / LGICZ

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit ZACN / LGICZ.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZACN / LGICZ

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms L2, LGICZ1, Ligand-gated ion channel zinc-activated 1, Ligand-gated ion-channel receptor L2, ZAC, Zinc-activated ligand-gated ion channel
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q401N2
Immunogen:
The immunogen for anti-LGICZ1 antibody: synthetic peptide directed towards the N terminal of human LGICZ1. Synthetic peptide located within the following region: PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM.
GeneID:
353174
Application WB
Background LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels (Davies et al., 2003 [PubMed 12381728]).[supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combition :: AB223030.1, BC110597.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZACN / LGICZ (1 products)

Catalog No. Species Pres. Purity   Source  

ZACN overexpression lysate

ZACN overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn