TA338786 ASIC4 / ACCN4 antibody

Rabbit Polyclonal Anti-ACCN4 Antibody

See related secondary antibodies

Search for all "ASIC4 / ACCN4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASIC4 / ACCN4

Product Description for ASIC4 / ACCN4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASIC4 / ACCN4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASIC4 / ACCN4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acid-sensing ion channel 4, Amiloride-sensitive cation channel 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96FT7
Immunogen:
The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4. Synthetic peptide located within the following region: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA.
GeneID:
55515
Application WB
Background This gene belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in syptic transmission, pain perception as well as mechanoperception. This gene is predomintly expressed in the pituitary gland, and was considered a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder, however, no correlation was found between mutations in this gene and PDC. [provided by RefSeq, Feb 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ASIC4 / ACCN4 (1 products)

Catalog No. Species Pres. Purity   Source  

ASIC4 / ACCN4 (transcript variant 2)

ASIC4 / ACCN4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ASIC4 / ACCN4 (2 products)

Catalog No. Species Pres. Purity   Source  

ACCN4 Lysate

Western Blot: ACCN4 Lysate [NBL1-07233] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACCN4 Protein
  Novus Biologicals Inc.

ASIC4 overexpression lysate

ASIC4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn