TA338787 ASIC2 / ACCN1 antibody

Rabbit Polyclonal Anti-ACCN1 Antibody

See related secondary antibodies

Search for all "ASIC2 / ACCN1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ASIC2 / ACCN1

Product Description for ASIC2 / ACCN1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ASIC2 / ACCN1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASIC2 / ACCN1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acid-sensing ion channel 2, Amiloride-sensitive brain sodium channel, Amiloride-sensitive cation channel 1, Amiloride-sensitive cation channel neuronal 1, BNAC1, Brain sodium channel 1, MDEG, neuronal
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16515
Immunogen:
The immunogen for anti-ACCN1 antibody: synthetic peptide directed towards the middle region of human ACCN1. Synthetic peptide located within the following region: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA.
GeneID:
40
Application WB
Background This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitition. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Three altertively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ASIC2 / ACCN1 (1 products)

Catalog No. Species Pres. Purity   Source  

ASIC2 / ACCN1 (transcript variant 2)

ASIC2 / ACCN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ASIC2 / ACCN1 (3 products)

Catalog No. Species Pres. Purity   Source  

ACCN1 Lysate

Western Blot: ACCN1 Lysate [NBL1-07230] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACCN1 Protein
  Novus Biologicals Inc.

ASIC2 overexpression lysate

ASIC2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ASIC2 overexpression lysate

ASIC2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn