TA338799 TPTE antibody

Rabbit Polyclonal Anti-TPTE Antibody

See related secondary antibodies

Search for all "TPTE"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TPTE

Product Description for TPTE

Rabbit anti Human TPTE.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TPTE

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BJ-HCC-5, Cancer/testis antigen 44, Putative tyrosine-protein phosphatase TPTE, Transmembrane phosphatase with tensin homology
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56180
Immunogen:
The immunogen for anti-TPTE antibody: synthetic peptide directed towards the middle region of human TPTE. Synthetic peptide located within the following region: IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY.
GeneID:
7179
Application WB
Background This gene encodes a PTEN-related tyrosine phosphatase which may play a role in the sigl transduction pathways of the endocrine or spermatogenic function of the testis. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TPTE (5 products)

Catalog No. Species Pres. Purity   Source  

TPTE (transcript variant 2)

TPTE Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TPTE

TPTE Human Purified
  Abnova Taiwan Corp.

TPTE

TPTE Human Purified
  Abnova Taiwan Corp.

TPTE

TPTE Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TPTE

TPTE Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TPTE (5 products)

Catalog No. Species Pres. Purity   Source  

TPTE 293T Cell Transient Overexpression Lysate(Denatured)

TPTE 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TPTE Lysate

Western Blot: TPTE Lysate [NBL1-17235] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TPTE
  Novus Biologicals Inc.

TPTE overexpression lysate

TPTE overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TPTE overexpression lysate

TPTE overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

TPTE overexpression lysate

TPTE overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn