TA338811 TIRAP antibody

Rabbit Polyclonal Anti-TIRAP Antibody

See related secondary antibodies

Search for all "TIRAP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TIRAP

Product Description for TIRAP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat TIRAP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TIRAP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Adaptor protein Wyatt, MAL, MyD88 adapter-like protein, TIR domain-containing adapter protein, Toll/interleukin-1 receptor domain-containing adapter protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P58753
Immunogen:
The immunogen for anti-TIRAP antibody: synthetic peptide directed towards the middle region of human TIRAP. Synthetic peptide located within the following region: LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW.
GeneID:
114609
Application WB
Background The inte immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TIRAP (5 products)

Catalog No. Species Pres. Purity   Source  

TIRAP (transcript variant 3)

TIRAP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TIRAP (1-221, His-tag)

TIRAP Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

TIRAP (1-221, His-tag)

TIRAP Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

TIRAP

TIRAP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TIRAP

TIRAP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TIRAP (1 products)

Catalog No. Species Pres. Purity   Source  

TIRAP 293T Cell Transient Overexpression Lysate(Denatured)

TIRAP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn