TA338831 C1orf216 (C-term) antibody

Rabbit Polyclonal Anti-5730409E04Rik Antibody

See related secondary antibodies

Search for all "C1orf216"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse C1orf216

Product Description for C1orf216

Rabbit anti Human, Mouse C1orf216.
Properties: (C-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for C1orf216

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UPF0500 protein C1orf216
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight C1orf216: 25 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8BP99
Immunogen:
Synthetic peptide corresponding to a C-terminal region of mouse C1orf216
AA Sequence:
RLALLQWIRALQHQLVDQQARLQESFDTILDNRKELIRCLQQREAPCRHQ
GeneID:
230757
Property C-term
Application Western blotting (1 µg/ml).
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.

Accessory Products

  • LinkedIn