TA338832 UBXN10 / UBXD3 (Center) antibody

Rabbit Polyclonal Anti-UBXN10 Antibody

See related secondary antibodies

Search for all "UBXN10 / UBXD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human UBXN10 / UBXD3

Product Description for UBXN10 / UBXD3

Rabbit anti Human UBXN10 / UBXD3.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for UBXN10 / UBXD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UBX domain-containing protein 10, UBX domain-containing protein 3
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight UBXD3: 31 kDa
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96LJ8
Immunogen:
Synthetic peptide directed towards the middle region of human UBXD3
AA Sequence:
PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI
GeneID:
127733
Property Center
Application Western blotting (0.2 - 1 µg/ml).
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for UBXN10 / UBXD3 (3 products)

Catalog No. Species Pres. Purity   Source  

UBXN10 / UBXD3

UBXN10 / UBXD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

UBXN10 / UBXD3

UBXN10 / UBXD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

UBXN10 / UBXD3

UBXN10 / UBXD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for UBXN10 / UBXD3 (2 products)

Catalog No. Species Pres. Purity   Source  

UBXN10 Lysate

Western Blot: UBXN10 Lysate [NBL1-17572] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UBXN10
  Novus Biologicals Inc.

UBXN10 overexpression lysate

UBXN10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn