TA338835 BBS5 antibody

Rabbit Polyclonal Anti-BBS5 Antibody

See related secondary antibodies

Search for all "BBS5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish BBS5

Product Description for BBS5

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat, Zebrafish BBS5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BBS5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Bardet-Biedl syndrome 5 protein
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N3I7
Immunogen:
The immunogen for anti-BBS5 antibody: synthetic peptide directed towards the middle region of human BBS5. Synthetic peptide located within the following region: VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW.
GeneID:
129880
Application WB
Background BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retil dystrophy, obesity, polydactyly, rel abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.This gene encodes a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retil dystrophy, obesity, polydactyly, rel abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia. Alterte transcriptiol splice variants have been observed but have not been fully characterized.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BBS5 (2 products)

Catalog No. Species Pres. Purity   Source  

BBS5

BBS5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

BBS5

BBS5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for BBS5 (3 products)

Catalog No. Species Pres. Purity   Source  

BBS5 Lysate(Denatured)

BBS5 Lysate(Denatured)
  Abnova Taiwan Corp.

BBS5 Lysate

Western Blot: BBS5 Lysate [NBL1-07930] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for BBS5. Protein
  Novus Biologicals Inc.

BBS5 overexpression lysate

BBS5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn