TA338836 IQCF1 antibody

Rabbit Polyclonal Anti-IQCF1 Antibody

See related secondary antibodies

Search for all "IQCF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IQCF1

Product Description for IQCF1

Rabbit anti Human IQCF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IQCF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IQ domain-containing protein F1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6M8
Immunogen:
The immunogen for anti-IQCF1 antibody: synthetic peptide directed towards the middle region of human IQCF1. Synthetic peptide located within the following region: ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF.
GeneID:
132141
Application WB
Background The exact function of IQCF1 is not known.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IQCF1 (2 products)

Catalog No. Species Pres. Purity   Source  

IQCF1

IQCF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IQCF1

IQCF1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for IQCF1 (2 products)

Catalog No. Species Pres. Purity   Source  

IQCF1 Lysate

Western Blot: IQCF1 Lysate [NBL1-12021] - Western Blot experiments. Left-Control; Right -Over-expression Lysate for IQCF1.
  Novus Biologicals Inc.

IQCF1 overexpression lysate

IQCF1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn