TA338899 NANP antibody

Rabbit Polyclonal Anti-NANP Antibody

See related secondary antibodies

Search for all "NANP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NANP

Product Description for NANP

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NANP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NANP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf147, HDHD4, N-acylneuraminate-9-phosphatase
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBE9
Immunogen:
The immunogen for anti-NANP antibody: synthetic peptide directed towards the middle region of human NANP. Synthetic peptide located within the following region: VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS.
GeneID:
140838
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NANP (7 products)

Catalog No. Species Pres. Purity   Source  

NANP

NANP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NANP (1-248, His-tag)

NANP Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

NANP (1-248, His-tag)

NANP Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

NANP

NANP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NANP

NANP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NANP

NANP Human Purified
  Novus Biologicals Inc.

NANP

NANP Human Purified
  Novus Biologicals Inc.

Positive controls for NANP (3 products)

Catalog No. Species Pres. Purity   Source  

NANP 293T Cell Transient Overexpression Lysate(Denatured)

NANP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NANP Lysate

Western Blot: NANP Lysate [NBL1-13466] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NANP
  Novus Biologicals Inc.

NANP overexpression lysate

NANP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn