discontinued

TA338912 ATP synthase subunit O antibody

Rabbit Polyclonal Anti-Atp5o Antibody

See related secondary antibodies

Search for all "ATP synthase subunit O"

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep ATP synthase subunit O

Product Description for ATP synthase subunit O

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep ATP synthase subunit O.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ATP synthase subunit O

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP5O, ATPO, Complex V subunit O, F1F0 ATP synthase subunit O, OSCP, Oligomycin sensitivity conferral protein, mitochondrial ATP synthase subunit O
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48047
Immunogen:
The immunogen for anti-Atp5o antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKEKKLDQVEKELLRV.
GeneID:
539
Application WB
Background Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha3beta3 subcomplex and subunit a/ATP6 static relative to the rotary elements.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ATP synthase subunit O (7 products)

Catalog No. Species Pres. Purity   Source  

ATP synthase subunit O

ATP synthase subunit O Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ATP synthase subunit O (24-213, His-tag)

ATP synthase subunit O Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

ATP synthase subunit O (24-213, His-tag)

ATP synthase subunit O Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

ATP synthase subunit O

ATP synthase subunit O Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP synthase subunit O

ATP synthase subunit O Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP synthase subunit O

ATP synthase subunit O Human Purified
  Novus Biologicals Inc.

ATP synthase subunit O

ATP synthase subunit O Human Purified
  Novus Biologicals Inc.

Positive controls for ATP synthase subunit O (3 products)

Catalog No. Species Pres. Purity   Source  

ATP5O Lysate(Denatured)

ATP5O Lysate(Denatured)
  Abnova Taiwan Corp.

ATP5O Lysate

Western Blot: ATP5O Lysate [NBL1-07829] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ATP5O Protein
  Novus Biologicals Inc.

ATP5O overexpression lysate

ATP5O overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn