TA338922 C21orf2 antibody

Rabbit Polyclonal Anti-C21orf2 Antibody

See related secondary antibodies

Search for all "C21orf2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C21orf2

TA338922

More Views

  • TA338922

Product Description for C21orf2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat C21orf2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C21orf2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C21orf-HUMF09G8.5, Uncharacterized protein C21orf2, YF5/A2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43822
Immunogen:
The immunogen for anti-C21orf2 antibody: synthetic peptide directed towards the N terminal of human C21orf2. Synthetic peptide located within the following region: KLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNS.
GeneID:
755
Application WB
Background Four altertively spliced transcript variants encoding four different isoforms have been found for this nuclear gene. All isoforms contain leucine-rich repeats. Three of these isoforms are mitochondrial proteins and one of them lacks the target peptide, so is not located in mitochondrion. This gene is down-regulated in Down syndrome (DS) brain, which may represent mitochondrial dysfunction in DS patients. [provided by RefSeq, Sep 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C21orf2 (4 products)

Catalog No. Species Pres. Purity   Source  

C21orf2

C21orf2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C21orf2

C21orf2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C21orf2

C21orf2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

C21orf2

C21orf2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for C21orf2 (1 products)

Catalog No. Species Pres. Purity   Source  

C21orf2 293T Cell Transient Overexpression Lysate(Denatured)

C21orf2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn