TA338927 CCT8 / TCP1 theta antibody

Rabbit Polyclonal Anti-CCT8 Antibody

See related secondary antibodies

Search for all "CCT8 / TCP1 theta"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CCT8 / TCP1 theta

Product Description for CCT8 / TCP1 theta

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CCT8 / TCP1 theta.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCT8 / TCP1 theta

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CCT theta, CCTQ, KIAA0002, NY-REN-15, Renal carcinoma antigen NY-REN-15, T-complex protein 1 subunit theta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50990
Immunogen:
The immunogen for Anti-CCT8 antibody is: synthetic peptide directed towards the N-terminal region of Human CCT8. Synthetic peptide located within the following region: LKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLF.
GeneID:
10694
Application WB
Background This gene encodes the theta subunit of the CCT chaperonin, which is abundant in the eukaryotic cytosol and may be involved in the transport and assembly of newly synthesized proteins. Altertive splicing results in multiple transcript variants of this gene. A pseudogene related to this gene is located on chromosome 1. [provided by RefSeq, Sep 2013].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCT8 / TCP1 theta (3 products)

Catalog No. Species Pres. Purity   Source  

CCT8 / TCP1 theta

CCT8 / TCP1 theta Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CCT8 / TCP1 theta

CCT8 / TCP1 theta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CCT8 / TCP1 theta

CCT8 / TCP1 theta Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CCT8 / TCP1 theta (3 products)

Catalog No. Species Pres. Purity   Source  

CCT8 293T Cell Transient Overexpression Lysate(Denatured)

CCT8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCT8 Lysate

Western Blot: CCT8 Lysate [NBL1-08903] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CCT8
  Novus Biologicals Inc.

CCT8 overexpression lysate

CCT8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn