TA338947 C21orf56 antibody

Rabbit Polyclonal Anti-C21orf56 Antibody

See related secondary antibodies

Search for all "C21orf56"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat C21orf56

Product Description for C21orf56

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rat C21orf56.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C21orf56

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C21orf56
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0A9
Immunogen:
The immunogen for anti-C21orf56 antibody: synthetic peptide directed towards the middle region of human C21orf56. Synthetic peptide located within the following region: EKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVV.
GeneID:
84221
Application WB
Background The exact function of C21orf56 remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C21orf56 (1 products)

Catalog No. Species Pres. Purity   Source  

C21orf56 (transcript variant 2)

C21orf56 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C21orf56 (2 products)

Catalog No. Species Pres. Purity   Source  

SPATC1L overexpression lysate

SPATC1L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SPATC1L overexpression lysate

SPATC1L overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn