TA338998 GOLGA5 antibody

Rabbit Polyclonal Anti-GOLGA5 Antibody

See related secondary antibodies

Search for all "GOLGA5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GOLGA5

TA338998

More Views

  • TA338998

Product Description for GOLGA5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GOLGA5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GOLGA5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Golgi marker, Golgin subfamily A member 5, Golgin-84, RET-fused gene 5 protein, RETII, RFG5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBA6
Immunogen:
The immunogen for anti-GOLGA5 antibody: synthetic peptide directed towards the N terminal of human GOLGA5. Synthetic peptide located within the following region: FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS.
GeneID:
9950
Application WB
Background The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cistere (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been desigted RET-II and PTC5. A pseudogene of this gene is located on the short arm of chromosome 5. [provided by RefSeq, Jul 2013].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GOLGA5 (4 products)

Catalog No. Species Pres. Purity   Source  

GOLGA5

GOLGA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GOLGA5

GOLGA5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GOLGA5

GOLGA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GOLGA5

GOLGA5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GOLGA5 (1 products)

Catalog No. Species Pres. Purity   Source  

GOLGA5 293T Cell Transient Overexpression Lysate(Denatured)

GOLGA5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn