TA339020 UST / DS2ST antibody

Rabbit Polyclonal Anti-UST Antibody

See related secondary antibodies

Search for all "UST / DS2ST"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat UST / DS2ST

TA339020

More Views

  • TA339020

Product Description for UST / DS2ST

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat UST / DS2ST.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for UST / DS2ST

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uronyl 2-sulfotransferase
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2C2
Immunogen:
The immunogen for anti-UST antibody: synthetic peptide directed towards the C terminal of human UST. Synthetic peptide located within the following region: YFKGVLSIYKDPEHRKLGNMTVTVKKTVPSPEAVQILYQRMRYEYEFYHY.
GeneID:
10090
Application WB
IHC
Background Uronyl 2-sulfotransferase transfers sulfate to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (Kobayashi et al., 1999 [PubMed 10187838]).[supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combition :: AB020316.1, AK292922.1 [ECO:0000332] Rseq introns :: single sample supports all introns ERS025082, ERS025083 [ECO:0000348] ##Evidence-Data-END##
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for UST / DS2ST (2 products)

Catalog No. Species Pres. Purity   Source  

UST Lysate

Western Blot: UST Lysate [NBL1-17674] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UST
  Novus Biologicals Inc.

UST overexpression lysate

UST overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn