TA339022 Tetraspanin-5 (TSPAN5) antibody

Rabbit Polyclonal Anti-TSPAN5 Antibody

See related secondary antibodies

Search for all "Tetraspanin-5 (TSPAN5)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Tetraspanin-5 (TSPAN5)

TA339022

More Views

  • TA339022

Product Description for Tetraspanin-5 (TSPAN5)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Tetraspanin-5 (TSPAN5).
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Tetraspanin-5 (TSPAN5)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TM4SF9, Tetraspan NET-4, Transmembrane 4 superfamily member 9, Tspan-5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62079
Immunogen:
The immunogen for anti-TSPAN5 antibody: synthetic peptide directed towards the middle region of human TSPAN5. Synthetic peptide located within the following region: ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ.
GeneID:
10098
Application WB
IHC
Background The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate sigl transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Tetraspanin-5 (TSPAN5) (2 products)

Catalog No. Species Pres. Purity   Source  

Tetraspanin-5 Lysate

Western Blot: Tetraspanin-5 Lysate [NBL1-17379] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TSPAN5
  Novus Biologicals Inc.

TSPAN5 overexpression lysate

TSPAN5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn