TA339047 CACNB2 antibody

Rabbit Polyclonal Anti-CACNB2 Antibody

See related secondary antibodies

Search for all "CACNB2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB2

Product Description for CACNB2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CACNB2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CACNB2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CAB2, CACNLB2, Calcium channel voltage-dependent subunit beta 2, Lambert-Eaton myasthenic syndrome antigen B, MYSB, Voltage-dependent L-type calcium channel subunit beta-2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q08289
Immunogen:
The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the C terminal of human CACNB2. Synthetic peptide located within the following region: APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASH.
GeneID:
783
Application WB
Background This gene encodes a subunit of a voltage-dependent calcium channel protein that is a member of the voltage-gated calcium channel superfamily. The gene product was origilly identified as an antigen target in Lambert-Eaton myasthenic syndrome, an autoimmune disorder. Mutations in this gene are associated with Brugada syndrome. Altertively spliced variants encoding different isoforms have been described. [provided by RefSeq, Feb 2013].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CACNB2 (2 products)

Catalog No. Species Pres. Purity   Source  

CACNB2

CACNB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CACNB2

CACNB2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CACNB2 (6 products)

Catalog No. Species Pres. Purity   Source  

CACNB2 overexpression lysate

CACNB2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB2 overexpression lysate

CACNB2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB2 overexpression lysate

CACNB2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB2 overexpression lysate

CACNB2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB2 overexpression lysate

CACNB2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB2 overexpression lysate

CACNB2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn