TA339127 SMARCE1-related protein antibody

Rabbit Polyclonal Anti-HMG20B Antibody

See related secondary antibodies

Search for all "SMARCE1-related protein"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat SMARCE1-related protein

Product Description for SMARCE1-related protein

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Rat SMARCE1-related protein.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMARCE1-related protein

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BRAF35, BRCA2-associated factor 35, HMG box-containing protein 20B, HMG domain-containing protein 2, HMG domain-containing protein HMGX2, HMG20B, HMGX2, HMGXB2, SMARCE1R, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related, Sox-like transcriptional factor, Structural DNA-binding protein BRAF35
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0W2
Immunogen:
The immunogen for anti-HMG20B antibody: synthetic peptide directed towards the middle region of human HMG20B. Synthetic peptide located within the following region: AELRRLRKMNVAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQ.
GeneID:
10362
Application WB
Background Required for correct progression through G2 phase of the cell cycle and entry into mitosis. Required for RCOR1/CoREST mediated repression of neurol specific gene promoters.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SMARCE1-related protein (4 products)

Catalog No. Species Pres. Purity   Source  

SMARCE1-related protein

SMARCE1-related protein Human Purified
  Abnova Taiwan Corp.

SMARCE1-related protein

SMARCE1-related protein Human Purified
  Abnova Taiwan Corp.

SMARCE1-related protein

SMARCE1-related protein Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SMARCE1-related protein

SMARCE1-related protein Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SMARCE1-related protein (3 products)

Catalog No. Species Pres. Purity   Source  

BRAF35 Lysate

Western Blot: BRAF35 Lysate [NBL1-11607] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HMG20B
  Novus Biologicals Inc.

HMG20B 293T Cell Transient Overexpression Lysate(Denatured)

HMG20B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HMG20B overexpression lysate

HMG20B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn