TA339165 DYNLL1 antibody

Rabbit Polyclonal Anti-DYNLL1

See related secondary antibodies

Search for all "DYNLL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DYNLL1

Product Description for DYNLL1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DYNLL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DYNLL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 8 kDa dynein light chain, DLC1, DLC8, DNCL1, DNCLC1, Dynein light chain 1, Dynein light chain 1 cytoplasmic, Dynein light chain LC8-type 1, HDLC1, PIN, Protein inhibitor of neuronal nitric oxide synthase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P63167
Immunogen:
The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the middle region of human DYNLL1. Synthetic peptide located within the following region: EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL.
GeneID:
8655
Application WB
Background Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neurol nitric oxide synthase. Binding of this protein destabilizes the neurol nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neurol nitric oxide synthase. Binding of this protein destabilizes the neurol nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alterte transcriptiol splice variants have been characterized.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DYNLL1 (12 products)

Catalog No. Species Pres. Purity   Source  

DYNLL1 (transcript variant 2)

DYNLL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DYNLL1 (transcript variant 3)

DYNLL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DYNLL1 (transcript variant 1)

DYNLL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DYNLL1 (transcript variant 1)

DYNLL1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

DYNLL1 (1-89, His-tag)

DYNLL1 Human Purified > 90 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

DYNLL1 (1-89, His-tag)

DYNLL1 Human Purified > 90 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

DYNLL1

DYNLL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DYNLL1

DYNLL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DYNLL1

DYNLL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DYNLL1

DYNLL1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DYNLL1

DYNLL1 Human Purified
  Novus Biologicals Inc.

DYNLL1

DYNLL1 Human Purified
  Novus Biologicals Inc.
  • LinkedIn