TA339186 PEG10 antibody

Rabbit Polyclonal Anti-PEG10

See related secondary antibodies

Search for all "PEG10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit PEG10

Product Description for PEG10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit PEG10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PEG10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EDR, Embryonal carcinoma differentiation-regulated protein, KIAA1051, MAR2, MART2, MEF3-like protein 1, MEF3L1, Mammalian retrotransposon-derived protein 2, Myelin expression factor 3-like protein 1, Paternally expressed gene 10 protein, RGAG3, Retrotransposon gag domain-containing protein 3, Retrotransposon-derived gag-like polyprotein, Retrotransposon-derived protein PEG10, Ty3/Gypsy-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86TG7
Immunogen:
The immunogen for Anti-PEG10 antibody is: synthetic peptide directed towards the C-terminal region of Human PEG10. Synthetic peptide located within the following region: RKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLY.
GeneID:
23089
Application WB
Background This is a paterlly expressed imprinted gene that encodes transcripts containing two overlapping open reading frames (ORFs), RF1 and RF1/RF2, as well as retroviral-like slippage and pseudoknot elements, which can induce a -1 nucleotide frame-shift. ORF1 encodes a shorter isoform with a CCHC-type zinc finger motif containing a sequence characteristic of gag proteins of most retroviruses and some retrotransposons. The longer isoform is the result of -1 translatiol frame-shifting leading to translation of a gag/pol-like protein combining RF1 and RF2. It contains the active-site consensus sequence of the protease domain of pol proteins. Additiol isoforms resulting from altertively spliced transcript variants, as well as from use of upstream non-AUG (CUG) start codon, have been reported for this gene.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PEG10 (3 products)

Catalog No. Species Pres. Purity   Source  

PEG10 (transcript variant 1)

PEG10 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PEG10

PEG10 Human Purified
  Abnova Taiwan Corp.

PEG10

PEG10 Human Purified
  Abnova Taiwan Corp.

Positive controls for PEG10 (5 products)

Catalog No. Species Pres. Purity   Source  

PEG10 293T Cell Transient Overexpression Lysate(Denatured)

PEG10 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PEG10 Lysate

Western Blot: PEG10 Lysate [NBL1-14279] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PEG10
  Novus Biologicals Inc.

PEG10 Lysate

Western Blot: PEG10 Lysate [NBL1-14280] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PEG10
  Novus Biologicals Inc.

PEG10 overexpression lysate

PEG10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PEG10 overexpression lysate

PEG10 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn