TA339190 CD42b / GPIbA antibody

Rabbit Polyclonal Anti-GP1BA

See related secondary antibodies

Search for all "CD42b / GPIbA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human, Rat CD42b / GPIbA

Product Description for CD42b / GPIbA

Rabbit anti Guinea Pig, Human, Rat CD42b / GPIbA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD42b / GPIbA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GP-Ib alpha, GPIb-alpha, Glycoprotein Ibalpha, Platelet glycoprotein Ib alpha chain
Presentation Purified
Reactivity GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P07359
Immunogen:
The immunogen for Anti-GP1BA antibody is: synthetic peptide directed towards the middle region of Human GP1BA. Synthetic peptide located within the following region: TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS.
GeneID:
2811
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD42b / GPIbA (4 products)

Catalog No. Species Pres. Purity   Source  

CD42b / GPIbA

CD42b / GPIbA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD42b / GPIbA

CD42b / GPIbA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CD42b / GPIbA

CD42b / GPIbA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD42b / GPIbA

CD42b / GPIbA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn