TA339199 IZUMO1 antibody

Rabbit Polyclonal Anti-IZUMO1

See related secondary antibodies

Search for all "IZUMO1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IZUMO1

Product Description for IZUMO1

Rabbit anti Human IZUMO1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IZUMO1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Izumo sperm-egg fusion protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYV9
Immunogen:
The immunogen for anti-IZUMO1 antibody: synthetic peptide directed towards the C terminal of human IZUMO1. Synthetic peptide located within the following region: SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ.
GeneID:
284359
Application WB
Background The sperm-specific protein Izumo, med for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion.The sperm-specific protein Izumo, med for a Japanese shrine dedicated to marriage, is essential for sperm-egg plasma membrane binding and fusion (Inoue et al., 2005 [PubMed 15759005]).[supplied by OMIM].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IZUMO1 (1 products)

Catalog No. Species Pres. Purity   Source  

IZUMO1

IZUMO1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for IZUMO1 (2 products)

Catalog No. Species Pres. Purity   Source  

IZUMO1 Lysate

Western Blot: IZUMO1 Lysate [NBL1-12090] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IZUMO1
  Novus Biologicals Inc.

IZUMO1 overexpression lysate

IZUMO1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn