TA339204 Cyclophilin A antibody

Rabbit Polyclonal Anti-PPIA

See related secondary antibodies

Search for all "Cyclophilin A"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep Cyclophilin A

TA339204

More Views

  • TA339204

Product Description for Cyclophilin A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep Cyclophilin A.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Cyclophilin A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CYPA, Cyclophilin-A, Cyclosporin A-binding protein, EC=5.2.1.8, PPIA, PPIase A, Peptidyl-prolyl cis-trans isomerase A, Rotamase A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62937
Immunogen:
The immunogen for anti-PPIA antibody: synthetic peptide directed towards the middle region of human PPIA. Synthetic peptide located within the following region: TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE.
GeneID:
5478
Application WB
IHC
Background PPIA is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. PPIA is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a cyclosporin binding-protein. It may play a role in cyclosporin A-mediated immunosuppression. This protein can interact with several HIV proteins including p55 gag, Vpr, and capsid protein. It has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. Three altertively spliced transcript variants encoding two distinct isoforms have been observed.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclophilin A (16 products)

Catalog No. Species Pres. Purity   Source  

Cyclophilin A

Cyclophilin A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Cyclophilin A (1-165, His-tag)

Cyclophilin A (PPIA): 15% SDS-PAGE (3 µg) Human Purified > 95 % by SDS PAGE E. coli
0.5 mg / €720.00
  OriGene Technologies GmbH

Cyclophilin A (1-165, His-tag)

Cyclophilin A (PPIA): 15% SDS-PAGE (3 µg) Human Purified > 95 % by SDS PAGE E. coli
0.1 mg / €290.00
  OriGene Technologies GmbH

Cyclophilin A

Cyclophilin A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclophilin A

Cyclophilin A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclophilin A

Cyclophilin A Human Purified
  Abnova Taiwan Corp.

Cyclophilin A

Cyclophilin A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclophilin A

Cyclophilin A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclophilin A

Cyclophilin A Human Purified
  Abnova Taiwan Corp.

Cyclophilin A

Cyclophilin A Human Purified
  Abnova Taiwan Corp.

Cyclophilin A

Cyclophilin A Human
  Abnova Taiwan Corp.

Cyclophilin A

SDS-Page: Cyclophilin A Protein [NBC1-18425] - Cyclophilin A, 20kDa (185aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE. Protein
  Novus Biologicals Inc.

Cyclophilin A

Cyclophilin A Human Purified
  Novus Biologicals Inc.

Cyclophilin A (1-165)

Human CypA (Cyclophilin A) recombinant protein Human Purified > 95 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-GST serum (WB) and peptide fingerprinting by MALDI-TOF-TOF mass spectrometry E. coli
  Protein Alternatives

Cyclophilin A (1-165)

Human CypA (Cyclophilin A) recombinant protein Human Purified > 95 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-GST serum (WB) and peptide fingerprinting by MALDI-TOF-TOF mass spectrometry E. coli
  Protein Alternatives

Cyclophilin A (1-165)

Human CypA (Cyclophilin A) recombinant protein Human Purified > 95 % 10% SDS-PAGE stained with Coomassie Blue (CB), immunobloting with anti-GST serum (WB) and peptide fingerprinting by MALDI-TOF-TOF mass spectrometry E. coli
  Protein Alternatives

Positive controls for Cyclophilin A (1 products)

Catalog No. Species Pres. Purity   Source  

Cyclophilin A Lysate

Western Blot: Cyclophilin A Lysate [NBL1-14645] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPIA
  Novus Biologicals Inc.
  • LinkedIn