TA339216 GBX1 antibody

Rabbit Polyclonal Anti-GBX1

See related secondary antibodies

Search for all "GBX1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GBX1

Product Description for GBX1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish GBX1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GBX1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Gastrulation and brain-specific homeobox protein 1, Homeobox protein GBX-1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14549
Immunogen:
The immunogen for anti-GBX-1 antibody: synthetic peptide directed towards the middle region of human GBX-1. Synthetic peptide located within the following region: AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP.
GeneID:
2636
Application WB
Background GBX1 contains 1 homeobox D-binding domain. The exact functions of GBX1 remain unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GBX1 (1 products)

Catalog No. Species Pres. Purity   Source  

GBX1

GBX1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for GBX1 (1 products)

Catalog No. Species Pres. Purity   Source  

GBX1 overexpression lysate

GBX1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn