TA339217 ZNF14 antibody

Rabbit Polyclonal Anti-ZNF14

See related secondary antibodies

Search for all "ZNF14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ZNF14

Product Description for ZNF14

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ZNF14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GIOT-4, GIOT4, Gonadotropin-inducible transcription repressor 4, KOX6, Zinc finger protein 14, Zinc finger protein KOX6
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17017
Immunogen:
The immunogen for anti-ZNF14 antibody: synthetic peptide directed towards the N terminal of human ZNF14. Synthetic peptide located within the following region: IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC.
GeneID:
7561
Application WB
Background ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptiol repression of a number of zinc finger proteins.The protein encoded by this gene contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptiol repression of a number of zinc finger proteins.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF14 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF14

ZNF14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF14

ZNF14 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn