TA339240 NUFIP2 antibody

Rabbit Polyclonal Anti-NUFIP2

See related secondary antibodies

Search for all "NUFIP2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NUFIP2

Product Description for NUFIP2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish NUFIP2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NUFIP2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 82 kDa FMRP-interacting protein, Cell proliferation-inducing gene 1 protein, FMRP-interacting protein 2, KIAA1321, Nuclear fragile X mental retardation-interacting protein 2, PIG1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z417
Immunogen:
The immunogen for anti-NUFIP2 antibody: synthetic peptide directed towards the N terminal of human NUFIP2. Synthetic peptide located within the following region: IPNGVVTNNSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCE.
GeneID:
57532
Application WB
Background NUFIP2 binds R. It is phosphorylated upon D damage, probably by ATM or ATR. The exact functions of NUFIP2 remain unknown.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn