TA339262 ATIC / PURH antibody

Rabbit Polyclonal Anti-ATIC Antibody

See related secondary antibodies

Search for all "ATIC / PURH"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast ATIC / PURH

TA339262

More Views

  • TA339262

Product Description for ATIC / PURH

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast ATIC / PURH.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ATIC / PURH

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Bifunctional purine biosynthesis protein PURH, IMP cyclohydrolase, IMP synthetase, Inosinicase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P31939
Immunogen:
The immunogen for anti-ATIC antibody: synthetic peptide directed towards the middle region of human ATIC. Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT.
GeneID:
471
Application WB
IHC
Background This gene encodes a bifunctiol protein that catalyzes the last two steps of the de novo purine biosynthetic pathway. The N-termil domain has phosphoribosylaminoimidazolecarboxamide formyltransferase activity, and the C-termil domain has IMP cyclohydrolase activity. A mutation in this gene results in AICA-ribosiduria. [provided by RefSeq, Sep 2009].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ATIC / PURH (3 products)

Catalog No. Species Pres. Purity   Source  

ATIC / PURH

ATIC / PURH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ATIC / PURH

ATIC / PURH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ATIC / PURH

ATIC / PURH Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ATIC / PURH (2 products)

Catalog No. Species Pres. Purity   Source  

ATIC 293T Cell Transient Overexpression Lysate(Denatured)

ATIC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ATIC Lysate

Western Blot: ATIC Lysate [NBL1-07801] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ATIC Protein
  Novus Biologicals Inc.
  • LinkedIn