TA339269 CAD Protein antibody

Rabbit Polyclonal Anti-CAD Antibody

See related secondary antibodies

Search for all "CAD Protein"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish CAD Protein

TA339269

More Views

  • TA339269

Product Description for CAD Protein

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish CAD Protein.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CAD Protein

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACTase, Aspartate carbamoyltransferase, DHOase, Dihydroorotase, GATase, Glutamine-dependent carbamoyl-phosphate synthase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P27708
Immunogen:
The immunogen for anti-CAD antibody: synthetic peptide directed towards the N terminal of human CAD. Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV.
GeneID:
790
Application WB
Background The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctiol protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kise (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CAD Protein (2 products)

Catalog No. Species Pres. Purity   Source  

CAD Protein

CAD Protein Human Purified
  Novus Biologicals Inc.

CAD Protein

CAD Protein Human Purified
  Novus Biologicals Inc.
  • LinkedIn