TA339315 Malectin antibody

Rabbit Polyclonal Anti-KIAA0152 Antibody

See related secondary antibodies

Search for all "Malectin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Malectin

Product Description for Malectin

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Malectin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Malectin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0152, MLEC
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14165
Immunogen:
The immunogen for anti-KIAA0152 antibody: synthetic peptide directed towards the C terminal of human KIAA0152. Synthetic peptide located within the following region: TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP.
GeneID:
9761
Application WB
Background Carbohydrate-binding protein with a strong ligand preference for Glc2-N-glycan. May play a role in the early steps of protein N-glycosylation.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Malectin (3 products)

Catalog No. Species Pres. Purity   Source  

Malectin

Malectin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Malectin (29-269, His-tag)

Malectin Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

Malectin (29-269, His-tag)

Malectin Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

Positive controls for Malectin (1 products)

Catalog No. Species Pres. Purity   Source  

MLEC overexpression lysate

MLEC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn